JPhyloIO event lister

Source: https://secure.bioinfweb.info/Code/svn/JPhyloIO/trunk/demo/info.bioinfweb.jphyloio.demo.eventwebview/data/examples/phyloXML/LargeExample.xml

JPhyloIO version: 0.5.4-1672 alpha

Event stream

DOCUMENT.START (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

TREE_NETWORK_GROUP.START (info.bioinfweb.jphyloio.events.LinkedLabeledIDEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null

NETWORK.START (info.bioinfweb.jphyloio.events.LabeledIDEvent) [JavaDoc] [Source code]

Properties:

  • label: "example from Prof. Joe Felsenstein's book "Inferring Phylogenies""

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Phylogeny.Description, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "phyloXML allows to use either a "branch_length" attribute or element to indicate branch lengths."

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "A"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "B"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.102
  • targetID: "n5"
  • sourceID: "n4"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.23
  • targetID: "n6"
  • sourceID: "n4"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "C"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: true

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.06
  • targetID: "n4"
  • sourceID: "n3"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.4
  • targetID: "n11"
  • sourceID: "n3"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.START (info.bioinfweb.jphyloio.events.LabeledIDEvent) [JavaDoc] [Source code]

Properties:

  • label: "example from Prof. Joe Felsenstein's book "Inferring Phylogenies""

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Phylogeny.Description, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "phyloXML allows to use either a "branch_length" attribute or element to indicate branch lengths."

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "A"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "B"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.102
  • targetID: "n20"
  • sourceID: "n19"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.23
  • targetID: "n21"
  • sourceID: "n19"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "C"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: true

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.06
  • targetID: "n19"
  • sourceID: "n18"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.4
  • targetID: "n26"
  • sourceID: "n18"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.START (info.bioinfweb.jphyloio.events.LabeledIDEvent) [JavaDoc] [Source code]

Properties:

  • label: "same example, with support of type "bootstrap""

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "A"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "B"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "AB"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.102
  • targetID: "n37"
  • sourceID: "n33"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.23
  • targetID: "n38"
  • sourceID: "n33"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "C"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: true

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.06
  • targetID: "n33"
  • sourceID: "n32"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Confidence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Confidence.Type, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "bootstrap"
  • stringValue: "bootstrap"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}double, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Confidence.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: 89.0
  • stringValue: "89"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.4
  • targetID: "n43"
  • sourceID: "n32"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.START (info.bioinfweb.jphyloio.events.LabeledIDEvent) [JavaDoc] [Source code]

Properties:

  • label: "same example, with species and sequence"

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "A"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "E. coli"
  • stringValue: "E. coli"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Desc, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "alcohol dehydrogenase"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence.Type, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "probability"
  • stringValue: "probability"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}double, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: 0.99
  • stringValue: "0.99"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "B"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "B. subtilis"
  • stringValue: "B. subtilis"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Desc, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "alcohol dehydrogenase"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence.Type, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "probability"
  • stringValue: "probability"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}double, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: 0.91
  • stringValue: "0.91"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "AB"
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n51"
  • sourceID: "n50"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n60"
  • sourceID: "n50"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "C"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "C. elegans"
  • stringValue: "C. elegans"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Desc, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "alcohol dehydrogenase"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence.Type, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "probability"
  • stringValue: "probability"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}double, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Confidence.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: 0.67
  • stringValue: "0.67"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: true

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n50"
  • sourceID: "n49"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n73"
  • sourceID: "n49"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.START (info.bioinfweb.jphyloio.events.LabeledIDEvent) [JavaDoc] [Source code]

Properties:

  • label: "same example, with gene duplication information and sequence relationships"

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "Bacillus subtilis"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "Bacillus subtilis"
  • stringValue: "Bacillus subtilis"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}IDSource, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "x"
  • stringValue: "x"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.SequenceSymbol, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Symbol, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "adhB"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Source, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "ncbi"
  • stringValue: "ncbi"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "AAB80874"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Name, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "alcohol dehydrogenase"
  • stringValue: "alcohol dehydrogenase"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "Bacillus subtilis"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "Bacillus subtilis"
  • stringValue: "Bacillus subtilis"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}IDSource, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "y"
  • stringValue: "y"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.SequenceSymbol, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Symbol, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "gbsB"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Source, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "ncbi"
  • stringValue: "ncbi"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "CAB15083"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Name, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "alcohol dehydrogenase"
  • stringValue: "alcohol dehydrogenase"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Events, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}nonNegativeInteger , null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Events.Duplications, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: 1
  • stringValue: "1"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n93"
  • sourceID: "n90"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n103"
  • sourceID: "n90"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "Caenorhabditis elegans"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "Caenorhabditis elegans"
  • stringValue: "Caenorhabditis elegans"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}IDSource, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "z"
  • stringValue: "z"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.SequenceSymbol, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Symbol, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "ADHX"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Source, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "ncbi"
  • stringValue: "ncbi"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "Q17335"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Name, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "alcohol dehydrogenase"
  • stringValue: "alcohol dehydrogenase"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Ref, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "InterPro:IPR002085"
  • stringValue: "InterPro:IPR002085"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: true

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Events, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}nonNegativeInteger , null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Events.Speciations, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: 1
  • stringValue: "1"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n90"
  • sourceID: "n87"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n117"
  • sourceID: "n87"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.IDRef0, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "x"
  • stringValue: "x"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.IDRef1, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "y"
  • stringValue: "y"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.Type, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "paralogy"
  • stringValue: "paralogy"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.IDRef0, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "x"
  • stringValue: "x"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.IDRef1, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "z"
  • stringValue: "z"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.Type, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "orthology"
  • stringValue: "orthology"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.IDRef0, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "y"
  • stringValue: "y"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.IDRef1, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "z"
  • stringValue: "z"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}SequenceRelation.Type, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "orthology"
  • stringValue: "orthology"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.START (info.bioinfweb.jphyloio.events.LabeledIDEvent) [JavaDoc] [Source code]

Properties:

  • label: "similar example, with more detailed sequence data"

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "Octopus vulgaris"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID.Provider, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "NCBI"
  • stringValue: "NCBI"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "6645"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.TaxonomyCode, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.Code, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "OCTVU"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "Octopus vulgaris"
  • stringValue: "Octopus vulgaris"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.SequenceSymbol, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Symbol, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "ADHX"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Source, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "UniProtKB"
  • stringValue: "UniProtKB"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "P81431"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Name, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "Alcohol dehydrogenase class-3"
  • stringValue: "Alcohol dehydrogenase class-3"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.MolSeq, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.MolSeq.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "TDATGKPIKCMAAIAWEAKKPLSIEEVEVAPPKSGEVRIKILHSGVCHTD"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Ref, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "EC:1.1.1.1"
  • stringValue: "EC:1.1.1.1"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Ref, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "GO:0004022"
  • stringValue: "GO:0004022"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "Dictyostelium discoideum"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID.Provider, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "NCBI"
  • stringValue: "NCBI"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "44689"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.TaxonomyCode, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.Code, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "DICDI"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "Dictyostelium discoideum"
  • stringValue: "Dictyostelium discoideum"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.SequenceSymbol, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Symbol, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "RT4I1"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Source, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "UniProtKB"
  • stringValue: "UniProtKB"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "Q54II4"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Name, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "Reticulon-4-interacting protein 1 homolog, mitochondrial precursor"
  • stringValue: "Reticulon-4-interacting protein 1 homolog, mitochondrial precursor"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.MolSeq, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.MolSeq.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "MKGILLNGYGESLDLLEYKTDLPVPKPIKSQVLIKIHSTSINPLDNVMRK"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Ref, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "GO:0008270"
  • stringValue: "GO:0008270"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Ref, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "GO:0016491"
  • stringValue: "GO:0016491"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n148"
  • sourceID: "n147"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n167"
  • sourceID: "n147"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "Clostridium acetobutylicum"
  • linkedID: null
  • rootNode: false

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy, null)

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID.Provider, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "NCBI"
  • stringValue: "NCBI"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ID.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "1488"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.TaxonomyCode, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.Code, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "CLOAB"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Taxonomy.ScientificName, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "Clostridium acetobutylicum"
  • stringValue: "Clostridium acetobutylicum"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/DataTypes/}Sequence.SequenceSymbol, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Symbol, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "ADHB"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Source, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "UniProtKB"
  • stringValue: "UniProtKB"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Accession.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "Q04945"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.Name, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "NADH-dependent butanol dehydrogenase B"
  • stringValue: "NADH-dependent butanol dehydrogenase B"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.MolSeq, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Sequence.MolSeq.Value, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: null
  • stringValue: "MVDFEYSIPTRIFFGKDKINVLGRELKKYGSKVLIVYGGGSIKRNGIYDK"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Ref, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "GO:0046872"
  • stringValue: "GO:0046872"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.START (info.bioinfweb.jphyloio.events.meta.ResourceMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • about: null
  • hRef: null
  • rel: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation, null)

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}Annotation.Ref, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "KEGG:Tetrachloroethene degradation"
  • stringValue: "KEGG:Tetrachloroethene degradation"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

RESOURCE_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: true

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n147"
  • sourceID: "n146"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n190"
  • sourceID: "n146"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.START (info.bioinfweb.jphyloio.events.LabeledIDEvent) [JavaDoc] [Source code]

Properties:

  • label: "network, node B is connected to TWO nodes: AB and C"

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "A"
  • linkedID: null
  • rootNode: false

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}IDSource, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "a"
  • stringValue: "a"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "B"
  • linkedID: null
  • rootNode: false

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}IDSource, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "b"
  • stringValue: "b"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "AB"
  • linkedID: null
  • rootNode: false

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}IDSource, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "ab"
  • stringValue: "ab"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.102
  • targetID: "n217"
  • sourceID: "n215"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.23
  • targetID: "n219"
  • sourceID: "n215"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: "C"
  • linkedID: null
  • rootNode: false

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}IDSource, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "c"
  • stringValue: "c"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NODE.START (info.bioinfweb.jphyloio.events.NodeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • linkedID: null
  • rootNode: false

NODE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.06
  • targetID: "n215"
  • sourceID: "n214"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: 0.4
  • targetID: "n225"
  • sourceID: "n214"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: false
  • stringValue: "false"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.START (info.bioinfweb.jphyloio.events.EdgeEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • length: NaN
  • targetID: "n225"
  • sourceID: "n219"

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}boolean, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/General/Predicates/}isCrosslink, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: true
  • stringValue: "true"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

LITERAL_META.START (info.bioinfweb.jphyloio.events.meta.LiteralMetadataEvent) [JavaDoc] [Source code]

Properties:

  • label: null
  • sequenceType: SIMPLE
  • originalType: ({http://www.w3.org/2001/XMLSchema}token, null)
  • alternativeStringValue: null
  • predicate: ({http://bioinfweb.info/xmlns/JPhyloIO/PhyloXML/Predicates/}CladeRelation.Type, null)

LITERAL_META_CONTENT.SOLE (info.bioinfweb.jphyloio.events.meta.LiteralMetadataContentEvent) [JavaDoc] [Source code]

Properties:

  • continuedInNextEvent: false
  • objectValue: "network_connection"
  • stringValue: "network_connection"

LITERAL_META.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

EDGE.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

NETWORK.END (info.bioinfweb.jphyloio.events.ConcreteJPhyloIOEvent) [JavaDoc] [Source code]

JPhyloIO event lister

JPhyloIO event lister

Source: https://secure.bioinfweb.info/Code/svn/JPhyloIO/trunk/demo/info.bioinfweb.jphyloio.demo.eventwebview/data/examples/phyloXML/LargeExample.xml

JPhyloIO version: 0.5.4-1672 alpha

Event stream

Exception when processing the file

The following exception occurred when trying to read the specified file. This is mostly caused by an invalid input file. If you think it is caused by an actual bug in JPhyloIO, please file a bug report with a description of the problem.

The content of this property tag could not be parsed to class BigInteger.

info.bioinfweb.jphyloio.exception.JPhyloIOReaderException: The content of this property tag could not be parsed to class BigInteger.
	at info.bioinfweb.jphyloio.formats.phyloxml.PhyloXMLEventReader$3.readEvent(Unknown Source)
	at info.bioinfweb.jphyloio.formats.phyloxml.PhyloXMLEventReader$3.readEvent(Unknown Source)
	at info.bioinfweb.jphyloio.formats.xml.AbstractXMLEventReader.readNextEvent(Unknown Source)
	at info.bioinfweb.jphyloio.AbstractEventReader.getNextEventFromQueue(Unknown Source)
	at info.bioinfweb.jphyloio.AbstractEventReader.next(Unknown Source)
	at info.bioinfweb.jphyloio.demo.eventwebview.EventListerServlet.outputEvents(EventListerServlet.java:169)
	at info.bioinfweb.jphyloio.demo.eventwebview.EventListerServlet.processStream(EventListerServlet.java:200)
	at info.bioinfweb.jphyloio.demo.eventwebview.EventListerServlet.doGet(EventListerServlet.java:239)
	at javax.servlet.http.HttpServlet.service(HttpServlet.java:622)
	at javax.servlet.http.HttpServlet.service(HttpServlet.java:729)
	at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:292)
	at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:207)
	at org.apache.tomcat.websocket.server.WsFilter.doFilter(WsFilter.java:52)
	at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:240)
	at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:207)
	at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:212)
	at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:94)
	at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:492)
	at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:141)
	at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:80)
	at org.apache.catalina.valves.AbstractAccessLogValve.invoke(AbstractAccessLogValve.java:620)
	at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:88)
	at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:502)
	at org.apache.coyote.ajp.AbstractAjpProcessor.process(AbstractAjpProcessor.java:870)
	at org.apache.coyote.AbstractProtocol$AbstractConnectionHandler.process(AbstractProtocol.java:684)
	at org.apache.tomcat.util.net.AprEndpoint$SocketProcessor.doRun(AprEndpoint.java:2527)
	at org.apache.tomcat.util.net.AprEndpoint$SocketProcessor.run(AprEndpoint.java:2516)
	at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1149)
	at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:624)
	at org.apache.tomcat.util.threads.TaskThread$WrappingRunnable.run(TaskThread.java:61)
	at java.lang.Thread.run(Thread.java:748)